PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G25190.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 331aa    MW: 34483.6 Da    PI: 9.554
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G25190.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.23.8e-30150206158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d+p+YVNaKQy++Il+RR +Rak+++e++l  k+rkpylheSRh+hA+rR+RgsgGrF
  OPUNC03G25190.2 150 DAPIYVNAKQYEGILRRRRARAKAQRENRL-VKGRKPYLHESRHRHAMRRARGSGGRF 206
                      68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.8E-33148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.01149209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-23152174IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-27152206IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-23183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MLSFKRSHEG FGHVAAAGAG PQQQPWWAGS QLLYGEASPE EAALRDGGQF QVVPGGRAAL  60
DPAAAAAAAP EPEKTAMPKR GGGGGAPEVL KFSVFSDNLE PGDTGEKTRE HSATIAMQSP  120
LPEYNGHFEL GLGQSMSGGR MLLPLNAPAD APIYVNAKQY EGILRRRRAR AKAQRENRLV  180
KGRKPYLHES RHRHAMRRAR GSGGRFLNTK KEAAAGGGSK TPLASLISPV DIVHPGSRGG  240
GGGGRASSLS GSDVSSPGGG MYDHHDVVVD AADHYSSIDH HIRTPFFTPL PIIMDGGGGD  300
HASHSAAAAA VAAPFRWATA AGDGCCELLK A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A3e-18150208261HAPB protein
4g92_A3e-18150208261HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190199RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880340.0AB288034.1 Oryza sativa Japonica Group OsHAP2H mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1063980.0AK106398.1 Oryza sativa Japonica Group cDNA clone:002-102-F12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628114.11e-150PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLA0A0E0KGU70.0A0A0E0KGU7_ORYPU; Uncharacterized protein
STRINGLOC_Os03g44540.11e-150(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.15e-23nuclear factor Y, subunit A6